PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_004571-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 353aa    MW: 39843.7 Da    PI: 6.738
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_004571-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.7e-162673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W+  Ed  l+d+v+++G g+W+++ r  g+ R++k+c++rw ++l
  AHYPO_004571-RA 26 KGPWSSSEDAVLIDYVNKHGEGNWNAVQRNTGLLRCGKSCRLRWANHL 73
                     79******************************99**********9986 PP

2Myb_DNA-binding53.17.4e-1779122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+++ +E+ l++d++++lG++ W++I+++++ gRt++++k++w++
  AHYPO_004571-RA  79 KGAFSSDEERLIIDLHAKLGNK-WARISAHLP-GRTDNEIKNYWNT 122
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.3472173IPR017930Myb domain
SuperFamilySSF466891.13E-2923120IPR009057Homeodomain-like
SMARTSM007173.7E-132575IPR001005SANT/Myb domain
PfamPF002494.0E-142673IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-222780IPR009057Homeodomain-like
CDDcd001671.95E-102873No hitNo description
PROSITE profilePS5129426.2674128IPR017930Myb domain
SMARTSM007175.0E-1678126IPR001005SANT/Myb domain
PfamPF002491.8E-1579122IPR001005SANT/Myb domain
CDDcd001678.22E-1281122No hitNo description
Gene3DG3DSA:1.10.10.608.3E-2581128IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009555Biological Processpollen development
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0090406Cellular Componentpollen tube
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MIMSKSTGGA GRQEMRIESN GGGLKKGPWS SSEDAVLIDY VNKHGEGNWN AVQRNTGLLR  60
CGKSCRLRWA NHLRPNLKKG AFSSDEERLI IDLHAKLGNK WARISAHLPG RTDNEIKNYW  120
NTRVKRRIRQ GLSLYPNDPP NPTPSLSLPK NPPQTLSLFN PMSLPSPIFP LHNPPPPFLP  180
FHHPLKQNSF MGNPNFPPSE MGSFQMNSIG FGLQSGQKMD FDQGFGLGNP SFELPSNQYN  240
QNVGGNYDHL EMEDEMIKDN LNMGIRTNSG LLDDLLIEAQ KKVCVKRETD HDFALHWDVS  300
SSENSCTGMK DQSEEEVKYD YQDIHNPQLP SFDYDADWNP GCYNWDNLPK IY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-29241285108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128RVKRRIR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00287DAPTransfer from AT2G32460Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666224.11e-143PREDICTED: myb-like protein A
TrEMBLA0A0J8B4X51e-143A0A0J8B4X5_BETVU; Uncharacterized protein
STRINGVIT_19s0090g00590.t016e-69(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.11e-67myb domain protein 33